HORDB

General Information

ID: hor006335
Uniprot ID: Q9VG55
Protein name: Hug-gamma
Gene name: Hug
Organism: Drosophila melanogaster (Fruit fly)
Family: Pyrokinin family
Source: animal
Expression: Expressed during embryogenesis through to adult stages with highest expression at later half of embryogenesis and during larval stages. |Expressed in a subgroup of neurosecretory cells in the subesophageal ganglion from embryonic stage 9 to larval stages.
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0008255 ecdysis-triggering hormone activity; GO:0016084 myostimulatory hormone activity; GO:0071855 neuropeptide receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0018990 ecdysis, chitin-based cuticle; GO:0030536 larval feeding behavior
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: QLQSNGEPAYRVRTPRL
Length: 17(121-137)
Propeptide: MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSPASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQEFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAEGATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD
Signal peptide: MCGPSYCTLLLIAASCYILVCSHA
Modification: T17 Leucine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Probably has a role in larval molting.
Mechanism: NA
Cross BBB: NA
Target: PK2-R1
Target Unid: Q9VFW5
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q9VG55-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006335_AF2.pdb

hor006335_ESM.pdb

Physical Information

Mass:	227079	Formula:	C85H141N29O26
Absent amino acids:	CDFHIKMW	Common amino acids:	R
pI:	11.05	Basic residues:	3
Polar residues:	5	Hydrophobic residues:	4
Hydrophobicity:	-119.41	Boman Index:	-5877
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	68.82
Instability Index:	4943.53	Extinction Coefficient cystines:	1490
Absorbance 280nm:	93.13

Literature

PubMed ID: 12204246
Title: The Drosophila hugin gene codes for myostimulatory and ecdysis-modifying neuropeptides.
PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 12537569
Title: A Drosophila full-length cDNA res
PubMed ID: 12171930
Title:
PubMed ID: 14690519
Title: