General Information

  • ID:  hor006335
  • Uniprot ID:  Q9VG55(121-137)
  • Protein name:  Hug-gamma
  • Gene name:  Hug
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  Expressed during embryogenesis through to adult stages with highest expression at later half of embryogenesis and during larval stages. |Expressed in a subgroup of neurosecretory cells in the subesophageal ganglion from embryonic stage 9 to larval stages.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0008255 ecdysis-triggering hormone activity; GO:0016084 myostimulatory hormone activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0018990 ecdysis, chitin-based cuticle; GO:0030536 larval feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QLQSNGEPAYRVRTPRL
  • Length:  17(121-137)
  • Propeptide:  MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSPASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQEFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAEGATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD
  • Signal peptide:  MCGPSYCTLLLIAASCYILVCSHA
  • Modification:  T17 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Probably has a role in larval molting.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PK2-R1
  • Target Unid:  Q9VFW5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VG55-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006335_AF2.pdbhor006335_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 227079 Formula: C85H141N29O26
Absent amino acids: CDFHIKMW Common amino acids: R
pI: 11.05 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -119.41 Boman Index: -5877
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 68.82
Instability Index: 4943.53 Extinction Coefficient cystines: 1490
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  12204246
  • Title:  The Drosophila hugin gene codes for myostimulatory and ecdysis-modifying neuropeptides.
  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  12537569
  • Title:  A Drosophila full-length cDNA res
  • PubMed ID:  12171930
  • Title:  
  • PubMed ID:  14690519
  • Title: